PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.L00170.1.p
Common NameLOC105961094, MIMGU_mgv1a012253mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family ZF-HD
Protein Properties Length: 257aa    MW: 28372.5 Da    PI: 7.3735
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.L00170.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer99.42.7e-3145100359
       ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                       k+rYkeClkNhA+ +Ggha+DGCgEf+++ g++gt ++lkCaAC+CHRnFHR+e+e 
  Migut.L00170.1.p  45 KFRYKECLKNHAVGMGGHALDGCGEFIAA-GDDGTLESLKCAACNCHRNFHRKENEA 100
                       789*************************9.999********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257747.0E-224199IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.9E-284698IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.2E-294797IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.1554897IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.79E-20179254IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-30184255IPR009057Homeodomain-like
TIGRFAMsTIGR015652.0E-27193249IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MEYEDQEEEQ DGELGLGPSY DDSPANSNPT RPTPLDSAAP PSLRKFRYKE CLKNHAVGMG  60
GHALDGCGEF IAAGDDGTLE SLKCAACNCH RNFHRKENEA AAAAAAAFAF HQHPQQQQLL  120
LTHHHHHPAH FGYRSPSGYL HVASAAAPHH HHQRAALLAL PSSSGGGDGG DGSGSRDEME  180
NYYSNPHMSS SGKKRFRTKF TAEQKDKMLN FAERLGWRIQ KQEEEMVQQF CGEMGIKRHV  240
LKVWMHNNKH TLGKKT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A5e-251942511875ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012840788.10.0PREDICTED: zinc-finger homeodomain protein 1-like
SwissprotA2Z2592e-72ZHD1_ORYSI; Zinc-finger homeodomain protein 1
SwissprotQ6YXH52e-72ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
TrEMBLA0A022R1T20.0A0A022R1T2_ERYGU; Uncharacterized protein
STRINGGLYMA02G04550.25e-80(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.16e-31homeobox protein 22